Placeholder image of a protein
Icon representing a puzzle

2277: Electron Density Reconstruction 31

Closed since about 3 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
March 10, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAG

Top groups


  1. Avatar for Go Science 100 pts. 17,757
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 17,745
  3. Avatar for Contenders 3. Contenders 54 pts. 17,685
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 17,654
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 17,654
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 18 pts. 17,624
  7. Avatar for Australia 7. Australia 12 pts. 17,618
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 17,613
  9. Avatar for BOINC@Poland 9. BOINC@Poland 5 pts. 17,484
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 17,290

  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 26 pts. 17,624
  2. Avatar for akaaka 22. akaaka Lv 1 24 pts. 17,624
  3. Avatar for alcor29 23. alcor29 Lv 1 22 pts. 17,621
  4. Avatar for AlkiP0Ps 24. AlkiP0Ps Lv 1 20 pts. 17,618
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 19 pts. 17,613
  6. Avatar for drjr 26. drjr Lv 1 17 pts. 17,607
  7. Avatar for NinjaGreg 27. NinjaGreg Lv 1 16 pts. 17,605
  8. Avatar for bamh 28. bamh Lv 1 14 pts. 17,576
  9. Avatar for Idiotboy 29. Idiotboy Lv 1 13 pts. 17,557
  10. Avatar for stomjoh 30. stomjoh Lv 1 12 pts. 17,553

Comments