Placeholder image of a protein
Icon representing a puzzle

2277: Electron Density Reconstruction 31

Closed since about 3 years ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary


Created
March 10, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAG

Top groups


  1. Avatar for Go Science 100 pts. 17,757
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 17,745
  3. Avatar for Contenders 3. Contenders 54 pts. 17,685
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 17,654
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 17,654
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 18 pts. 17,624
  7. Avatar for Australia 7. Australia 12 pts. 17,618
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 17,613
  9. Avatar for BOINC@Poland 9. BOINC@Poland 5 pts. 17,484
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 17,290

  1. Avatar for hansvandenhof 41. hansvandenhof Lv 1 4 pts. 17,405
  2. Avatar for blazegeek 42. blazegeek Lv 1 4 pts. 17,400
  3. Avatar for Oransche 43. Oransche Lv 1 3 pts. 17,398
  4. Avatar for Trajan464 44. Trajan464 Lv 1 3 pts. 17,392
  5. Avatar for maithra 45. maithra Lv 1 3 pts. 17,329
  6. Avatar for lconor 46. lconor Lv 1 3 pts. 17,312
  7. Avatar for Karlheinz 47. Karlheinz Lv 1 2 pts. 17,308
  8. Avatar for alyssa_d_V2.0 48. alyssa_d_V2.0 Lv 1 2 pts. 17,290
  9. Avatar for sitlux 49. sitlux Lv 1 2 pts. 17,254
  10. Avatar for andrewgood 50. andrewgood Lv 1 2 pts. 17,184

Comments