Placeholder image of a protein
Icon representing a puzzle

2277: Electron Density Reconstruction 31

Closed since about 3 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction Electron Density Electron Density Electron Density

Summary


Created
March 10, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAG

Top groups


  1. Avatar for Go Science 100 pts. 17,757
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 17,745
  3. Avatar for Contenders 3. Contenders 54 pts. 17,685
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 17,654
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 17,654
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 18 pts. 17,624
  7. Avatar for Australia 7. Australia 12 pts. 17,618
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 17,613
  9. Avatar for BOINC@Poland 9. BOINC@Poland 5 pts. 17,484
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 17,290

  1. Avatar for dcc5480 51. dcc5480 Lv 1 1 pt. 17,140
  2. Avatar for Larini 52. Larini Lv 1 1 pt. 17,135
  3. Avatar for abiogenesis 53. abiogenesis Lv 1 1 pt. 17,128
  4. Avatar for Dr.Sillem 54. Dr.Sillem Lv 1 1 pt. 17,113
  5. Avatar for zbp 55. zbp Lv 1 1 pt. 17,073
  6. Avatar for rosie4loop 56. rosie4loop Lv 1 1 pt. 17,070
  7. Avatar for carxo 57. carxo Lv 1 1 pt. 17,067
  8. Avatar for Mohoernchen 58. Mohoernchen Lv 1 1 pt. 17,021
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 17,011
  10. Avatar for mailman105 60. mailman105 Lv 1 1 pt. 16,983

Comments