Placeholder image of a protein
Icon representing a puzzle

2277: Electron Density Reconstruction 31

Closed since about 3 years ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction Electron Density Electron Density Electron Density

Summary


Created
March 10, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAG

Top groups


  1. Avatar for Go Science 100 pts. 17,757
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 17,745
  3. Avatar for Contenders 3. Contenders 54 pts. 17,685
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 17,654
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 17,654
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 18 pts. 17,624
  7. Avatar for Australia 7. Australia 12 pts. 17,618
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 17,613
  9. Avatar for BOINC@Poland 9. BOINC@Poland 5 pts. 17,484
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 17,290

  1. Avatar for pruneau_44 61. pruneau_44 Lv 1 1 pt. 16,979
  2. Avatar for AlphaFold2 62. AlphaFold2 Lv 1 1 pt. 16,973
  3. Avatar for DScott 63. DScott Lv 1 1 pt. 16,968
  4. Avatar for BioHazard001 64. BioHazard001 Lv 1 1 pt. 16,924
  5. Avatar for konikula 65. konikula Lv 1 1 pt. 16,888
  6. Avatar for NickMihal 66. NickMihal Lv 1 1 pt. 16,879
  7. Avatar for furi0us 67. furi0us Lv 1 1 pt. 16,870
  8. Avatar for WuWTq 68. WuWTq Lv 1 1 pt. 16,867
  9. Avatar for froschi2 69. froschi2 Lv 1 1 pt. 16,851
  10. Avatar for Swapper242 70. Swapper242 Lv 1 1 pt. 16,831

Comments