Placeholder image of a protein
Icon representing a puzzle

2277: Electron Density Reconstruction 31

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
March 10, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 17,757
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 17,745
  3. Avatar for Contenders 3. Contenders 54 pts. 17,685
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 17,654
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 17,654
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 18 pts. 17,624
  7. Avatar for Australia 7. Australia 12 pts. 17,618
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 17,613
  9. Avatar for BOINC@Poland 9. BOINC@Poland 5 pts. 17,484
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 17,290
  1. Avatar for MicElephant 11. MicElephant Lv 1 53 pts. 17,685
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 50 pts. 17,668
  3. Avatar for Aubade01 13. Aubade01 Lv 1 46 pts. 17,663
  4. Avatar for BootsMcGraw 14. BootsMcGraw Lv 1 43 pts. 17,659
  5. Avatar for Timo van der Laan 15. Timo van der Laan Lv 1 40 pts. 17,654
  6. Avatar for fpc 16. fpc Lv 1 37 pts. 17,654
  7. Avatar for BackBuffer 17. BackBuffer Lv 1 35 pts. 17,648
  8. Avatar for guineapig 18. guineapig Lv 1 32 pts. 17,641
  9. Avatar for NPrincipi 19. NPrincipi Lv 1 30 pts. 17,635
  10. Avatar for silent gene 20. silent gene Lv 1 28 pts. 17,625

Comments