Placeholder image of a protein
Icon representing a puzzle

2277: Electron Density Reconstruction 31

Closed since about 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
March 10, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAG

Top groups


  1. Avatar for Go Science 100 pts. 17,757
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 17,745
  3. Avatar for Contenders 3. Contenders 54 pts. 17,685
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 17,654
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 17,654
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 18 pts. 17,624
  7. Avatar for Australia 7. Australia 12 pts. 17,618
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 17,613
  9. Avatar for BOINC@Poland 9. BOINC@Poland 5 pts. 17,484
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 17,290

  1. Avatar for RichGuilmain 31. RichGuilmain Lv 1 11 pts. 17,550
  2. Avatar for roarshock 32. roarshock Lv 1 10 pts. 17,501
  3. Avatar for equilibria 33. equilibria Lv 1 9 pts. 17,488
  4. Avatar for ShadowTactics 34. ShadowTactics Lv 1 8 pts. 17,484
  5. Avatar for hada 35. hada Lv 1 8 pts. 17,482
  6. Avatar for drumpeter18yrs9yrs 36. drumpeter18yrs9yrs Lv 1 7 pts. 17,480
  7. Avatar for CAN1958 37. CAN1958 Lv 1 6 pts. 17,420
  8. Avatar for Wiz kid 38. Wiz kid Lv 1 6 pts. 17,413
  9. Avatar for ProfVince 39. ProfVince Lv 1 5 pts. 17,412
  10. Avatar for Crossed Sticks 40. Crossed Sticks Lv 1 5 pts. 17,409

Comments