Placeholder image of a protein
Icon representing a puzzle

2277: Electron Density Reconstruction 31

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
March 10, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREKLHTVKVLSASSYSPDEWERQCKVAG

Top groups


  1. Avatar for Go Science 100 pts. 17,757
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 17,745
  3. Avatar for Contenders 3. Contenders 54 pts. 17,685
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 17,654
  5. Avatar for Marvin's bunch 5. Marvin's bunch 27 pts. 17,654
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 18 pts. 17,624
  7. Avatar for Australia 7. Australia 12 pts. 17,618
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 17,613
  9. Avatar for BOINC@Poland 9. BOINC@Poland 5 pts. 17,484
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 17,290

  1. Avatar for Merf 71. Merf Lv 1 1 pt. 16,782
  2. Avatar for RicardoGiron 72. RicardoGiron Lv 1 1 pt. 16,770
  3. Avatar for Sammy3c2b1a0 73. Sammy3c2b1a0 Lv 1 1 pt. 16,758
  4. Avatar for April256 74. April256 Lv 1 1 pt. 16,753
  5. Avatar for psychopoet 75. psychopoet Lv 1 1 pt. 16,622
  6. Avatar for TgamesPi 76. TgamesPi Lv 1 1 pt. 16,017
  7. Avatar for apetrides 77. apetrides Lv 1 1 pt. 14,983
  8. Avatar for alexmueller2 78. alexmueller2 Lv 1 1 pt. 13,675
  9. Avatar for Mantelmann 79. Mantelmann Lv 1 1 pt. 12,413
  10. Avatar for shahparth 80. shahparth Lv 1 1 pt. 12,091

Comments