Icon representing a puzzle

2283: Revisiting Puzzle 73: Polycystein

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
March 29, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Team China 12. Team China 1 pt. 7,701
  2. Avatar for SHELL 13. SHELL 1 pt. 4,879

  1. Avatar for georg137 31. georg137 Lv 1 10 pts. 9,825
  2. Avatar for Idiotboy 32. Idiotboy Lv 1 9 pts. 9,812
  3. Avatar for dropbear 33. dropbear Lv 1 8 pts. 9,812
  4. Avatar for heather-1 34. heather-1 Lv 1 7 pts. 9,766
  5. Avatar for Hillbillie 35. Hillbillie Lv 1 7 pts. 9,745
  6. Avatar for drumpeter18yrs9yrs 36. drumpeter18yrs9yrs Lv 1 6 pts. 9,743
  7. Avatar for Merf 37. Merf Lv 1 6 pts. 9,670
  8. Avatar for ShadowTactics 38. ShadowTactics Lv 1 5 pts. 9,669
  9. Avatar for phi16 39. phi16 Lv 1 4 pts. 9,614
  10. Avatar for Wiz kid 40. Wiz kid Lv 1 4 pts. 9,582

Comments