Icon representing a puzzle

2283: Revisiting Puzzle 73: Polycystein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
March 29, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,699
  2. Avatar for Go Science 2. Go Science 65 pts. 10,647
  3. Avatar for Contenders 3. Contenders 41 pts. 10,452
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 10,378
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,214
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 10,051
  7. Avatar for Australia 7. Australia 4 pts. 9,972
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 9,669
  9. Avatar for VeFold 9. VeFold 1 pt. 9,321
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 9,264
  1. Avatar for georg137 31. georg137 Lv 1 10 pts. 9,825
  2. Avatar for Idiotboy 32. Idiotboy Lv 1 9 pts. 9,812
  3. Avatar for dropbear 33. dropbear Lv 1 8 pts. 9,812
  4. Avatar for heather-1 34. heather-1 Lv 1 7 pts. 9,766
  5. Avatar for Hillbillie 35. Hillbillie Lv 1 7 pts. 9,745
  6. Avatar for drumpeter18yrs9yrs 36. drumpeter18yrs9yrs Lv 1 6 pts. 9,743
  7. Avatar for Merf 37. Merf Lv 1 6 pts. 9,670
  8. Avatar for ShadowTactics 38. ShadowTactics Lv 1 5 pts. 9,669
  9. Avatar for phi16 39. phi16 Lv 1 4 pts. 9,614
  10. Avatar for Wiz kid 40. Wiz kid Lv 1 4 pts. 9,582

Comments