Icon representing a puzzle

2283: Revisiting Puzzle 73: Polycystein

Closed since about 3 years ago

Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 29, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Team China 12. Team China 1 pt. 7,701
  2. Avatar for SHELL 13. SHELL 1 pt. 4,879

  1. Avatar for sitlux 61. sitlux Lv 1 1 pt. 8,834
  2. Avatar for rezaefar 62. rezaefar Lv 1 1 pt. 8,799
  3. Avatar for Jackd4w 63. Jackd4w Lv 1 1 pt. 8,754
  4. Avatar for abskebabs 64. abskebabs Lv 1 1 pt. 8,725
  5. Avatar for Mohoernchen 65. Mohoernchen Lv 1 1 pt. 8,691
  6. Avatar for Dorane 66. Dorane Lv 1 1 pt. 8,391
  7. Avatar for firaysyam 67. firaysyam Lv 1 1 pt. 8,262
  8. Avatar for furi0us 68. furi0us Lv 1 1 pt. 8,124
  9. Avatar for frostschutz 69. frostschutz Lv 1 1 pt. 8,123

Comments