Icon representing a puzzle

2283: Revisiting Puzzle 73: Polycystein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
March 29, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,699
  2. Avatar for Go Science 2. Go Science 65 pts. 10,647
  3. Avatar for Contenders 3. Contenders 41 pts. 10,452
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 10,378
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,214
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 10,051
  7. Avatar for Australia 7. Australia 4 pts. 9,972
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 9,669
  9. Avatar for VeFold 9. VeFold 1 pt. 9,321
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 9,264
  1. Avatar for sitlux 61. sitlux Lv 1 1 pt. 8,834
  2. Avatar for rezaefar 62. rezaefar Lv 1 1 pt. 8,799
  3. Avatar for Jackd4w 63. Jackd4w Lv 1 1 pt. 8,754
  4. Avatar for abskebabs 64. abskebabs Lv 1 1 pt. 8,725
  5. Avatar for Mohoernchen 65. Mohoernchen Lv 1 1 pt. 8,691
  6. Avatar for Dorane 66. Dorane Lv 1 1 pt. 8,391
  7. Avatar for firaysyam 67. firaysyam Lv 1 1 pt. 8,262
  8. Avatar for furi0us 68. furi0us Lv 1 1 pt. 8,124
  9. Avatar for frostschutz 69. frostschutz Lv 1 1 pt. 8,123
  10. Avatar for Izzatania Ulfa Nuri 70. Izzatania Ulfa Nuri Lv 1 1 pt. 8,040

Comments