Icon representing a puzzle

2283: Revisiting Puzzle 73: Polycystein

Closed since about 3 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
March 29, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,699
  2. Avatar for Go Science 2. Go Science 65 pts. 10,647
  3. Avatar for Contenders 3. Contenders 41 pts. 10,452
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 10,378
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 14 pts. 10,214
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 10,051
  7. Avatar for Australia 7. Australia 4 pts. 9,972
  8. Avatar for BOINC@Poland 8. BOINC@Poland 2 pts. 9,669
  9. Avatar for VeFold 9. VeFold 1 pt. 9,321
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 9,264

  1. Avatar for Nai 71. Nai Lv 1 1 pt. 7,942
  2. Avatar for Swapper242 72. Swapper242 Lv 1 1 pt. 7,869
  3. Avatar for athalita 73. athalita Lv 1 1 pt. 7,838
  4. Avatar for lezhe 74. lezhe Lv 1 1 pt. 7,701
  5. Avatar for Sammy3c2b1a0 75. Sammy3c2b1a0 Lv 1 1 pt. 7,696
  6. Avatar for nvesprini 76. nvesprini Lv 1 1 pt. 7,604
  7. Avatar for DKP1 77. DKP1 Lv 1 1 pt. 7,556
  8. Avatar for Deleted player 78. Deleted player pts. 7,106
  9. Avatar for kanwal2468 79. kanwal2468 Lv 1 1 pt. 4,879
  10. Avatar for cairuoqing 80. cairuoqing Lv 1 1 pt. 4,879

Comments