Icon representing a puzzle

2285: Revisiting Puzzle 74: Platypus Venom

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,467
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,413
  3. Avatar for SP26 CHEM 351 Weldon 13. SP26 CHEM 351 Weldon 1 pt. 7,892
  4. Avatar for Q3 - Bioteknologi Protein 14. Q3 - Bioteknologi Protein 1 pt. 7,859
  5. Avatar for SHELL 15. SHELL 1 pt. 5,961
  1. Avatar for silent gene 21. silent gene Lv 1 29 pts. 9,399
  2. Avatar for Skippysk8s 22. Skippysk8s Lv 1 27 pts. 9,344
  3. Avatar for Hillbillie 23. Hillbillie Lv 1 26 pts. 9,337
  4. Avatar for ProfVince 24. ProfVince Lv 1 24 pts. 9,302
  5. Avatar for Idiotboy 25. Idiotboy Lv 1 22 pts. 9,291
  6. Avatar for blazegeek 26. blazegeek Lv 1 21 pts. 9,287
  7. Avatar for AlkiP0Ps 27. AlkiP0Ps Lv 1 19 pts. 9,246
  8. Avatar for guineapig 28. guineapig Lv 1 18 pts. 9,225
  9. Avatar for Oransche 29. Oransche Lv 1 16 pts. 9,217
  10. Avatar for fpc 30. fpc Lv 1 15 pts. 9,202

Comments