Icon representing a puzzle

2285: Revisiting Puzzle 74: Platypus Venom

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,467
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,413
  3. Avatar for SP26 CHEM 351 Weldon 13. SP26 CHEM 351 Weldon 1 pt. 7,892
  4. Avatar for Q3 - Bioteknologi Protein 14. Q3 - Bioteknologi Protein 1 pt. 7,859
  5. Avatar for SHELL 15. SHELL 1 pt. 5,961
  1. Avatar for hansvandenhof 31. hansvandenhof Lv 1 14 pts. 9,162
  2. Avatar for heather-1 32. heather-1 Lv 1 13 pts. 9,120
  3. Avatar for roarshock 33. roarshock Lv 1 12 pts. 9,118
  4. Avatar for bamh 34. bamh Lv 1 11 pts. 9,074
  5. Avatar for muffnerk 35. muffnerk Lv 1 10 pts. 9,058
  6. Avatar for rosie4loop 36. rosie4loop Lv 1 9 pts. 9,008
  7. Avatar for alcor29 37. alcor29 Lv 1 9 pts. 8,979
  8. Avatar for Wiz kid 38. Wiz kid Lv 1 8 pts. 8,942
  9. Avatar for Punzi Baker 3 39. Punzi Baker 3 Lv 1 7 pts. 8,835
  10. Avatar for abskebabs 40. abskebabs Lv 1 7 pts. 8,834

Comments