Icon representing a puzzle

2285: Revisiting Puzzle 74: Platypus Venom

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,467
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,413
  3. Avatar for SP26 CHEM 351 Weldon 13. SP26 CHEM 351 Weldon 1 pt. 7,892
  4. Avatar for Q3 - Bioteknologi Protein 14. Q3 - Bioteknologi Protein 1 pt. 7,859
  5. Avatar for SHELL 15. SHELL 1 pt. 5,961
  1. Avatar for rinze 61. rinze Lv 1 1 pt. 8,411
  2. Avatar for Steven Pletsch 62. Steven Pletsch Lv 1 1 pt. 8,302
  3. Avatar for sciencewalker 63. sciencewalker Lv 1 1 pt. 8,281
  4. Avatar for matt61ger 64. matt61ger Lv 1 1 pt. 8,259
  5. Avatar for Merf 65. Merf Lv 1 1 pt. 8,236
  6. Avatar for Nicekoo 66. Nicekoo Lv 1 1 pt. 8,214
  7. Avatar for B. A. Beder 67. B. A. Beder Lv 1 1 pt. 8,193
  8. Avatar for tolan_lord 68. tolan_lord Lv 1 1 pt. 8,178
  9. Avatar for User098123 69. User098123 Lv 1 1 pt. 8,124
  10. Avatar for Mohoernchen 70. Mohoernchen Lv 1 1 pt. 8,103

Comments