Icon representing a puzzle

2285: Revisiting Puzzle 74: Platypus Venom

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
April 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,467
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,413
  3. Avatar for SP26 CHEM 351 Weldon 13. SP26 CHEM 351 Weldon 1 pt. 7,892
  4. Avatar for SHELL 15. SHELL 1 pt. 5,961

  1. Avatar for Opolis 71. Opolis Lv 1 1 pt. 8,026
  2. Avatar for Dorane 72. Dorane Lv 1 1 pt. 8,021
  3. Avatar for pizpot 73. pizpot Lv 1 1 pt. 8,019
  4. Avatar for konikula 74. konikula Lv 1 1 pt. 8,000
  5. Avatar for Zitronenfalter 75. Zitronenfalter Lv 1 1 pt. 7,975
  6. Avatar for frostschutz 76. frostschutz Lv 1 1 pt. 7,961
  7. Avatar for jausmh 77. jausmh Lv 1 1 pt. 7,944
  8. Avatar for Swapper242 78. Swapper242 Lv 1 1 pt. 7,934
  9. Avatar for Dikkebaap 79. Dikkebaap Lv 1 1 pt. 7,901
  10. Avatar for pruneau_44 80. pruneau_44 Lv 1 1 pt. 7,900

Comments