Icon representing a puzzle

2285: Revisiting Puzzle 74: Platypus Venom

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,467
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 8,413
  3. Avatar for SP26 CHEM 351 Weldon 13. SP26 CHEM 351 Weldon 1 pt. 7,892
  4. Avatar for Q3 - Bioteknologi Protein 14. Q3 - Bioteknologi Protein 1 pt. 7,859
  5. Avatar for SHELL 15. SHELL 1 pt. 5,961
  1. Avatar for zbutt2023 81. zbutt2023 Lv 1 1 pt. 7,892
  2. Avatar for furi0us 82. furi0us Lv 1 1 pt. 7,876
  3. Avatar for firaysyam 83. firaysyam Lv 1 1 pt. 7,859
  4. Avatar for bergie72 84. bergie72 Lv 1 1 pt. 7,806
  5. Avatar for esgalippa 85. esgalippa Lv 1 1 pt. 7,747
  6. Avatar for WuWTq 86. WuWTq Lv 1 1 pt. 7,714
  7. Avatar for haolinshen 87. haolinshen Lv 1 1 pt. 6,936
  8. Avatar for U202143303 88. U202143303 Lv 1 1 pt. 5,961
  9. Avatar for U202143311 89. U202143311 Lv 1 1 pt. 5,933
  10. Avatar for Afif Ahmad Ma'ruf 90. Afif Ahmad Ma'ruf Lv 1 1 pt. 5,878

Comments