Icon representing a puzzle

2290: Revisiting Puzzle 75: Antifreeze Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 17, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Ogre's lab 11. Ogre's lab 1 pt. 9,617
  2. Avatar for VeFold 12. VeFold 1 pt. 9,518
  3. Avatar for Folders 13. Folders 1 pt. 9,285
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 9,281
  1. Avatar for DScott 61. DScott Lv 1 1 pt. 9,572
  2. Avatar for lconor 62. lconor Lv 1 1 pt. 9,564
  3. Avatar for rosie4loop 63. rosie4loop Lv 1 1 pt. 9,532
  4. Avatar for carxo 64. carxo Lv 1 1 pt. 9,518
  5. Avatar for fiendish_ghoul 65. fiendish_ghoul Lv 1 1 pt. 9,439
  6. Avatar for Mohoernchen 66. Mohoernchen Lv 1 1 pt. 9,408
  7. Avatar for Dr.Sillem 67. Dr.Sillem Lv 1 1 pt. 9,407
  8. Avatar for Merf 68. Merf Lv 1 1 pt. 9,314
  9. Avatar for rinze 69. rinze Lv 1 1 pt. 9,301
  10. Avatar for pruneau_44 70. pruneau_44 Lv 1 1 pt. 9,300

Comments