Icon representing a puzzle

2290: Revisiting Puzzle 75: Antifreeze Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 17, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,153
  2. Avatar for Go Science 2. Go Science 68 pts. 10,137
  3. Avatar for Contenders 3. Contenders 44 pts. 10,112
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,040
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,024
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 10,007
  7. Avatar for SHELL 7. SHELL 5 pts. 9,933
  8. Avatar for Australia 8. Australia 3 pts. 9,929
  9. Avatar for WISE 380 Spring 21 A 9. WISE 380 Spring 21 A 1 pt. 9,773
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,700
  1. Avatar for DScott 61. DScott Lv 1 1 pt. 9,572
  2. Avatar for lconor 62. lconor Lv 1 1 pt. 9,564
  3. Avatar for rosie4loop 63. rosie4loop Lv 1 1 pt. 9,532
  4. Avatar for carxo 64. carxo Lv 1 1 pt. 9,518
  5. Avatar for fiendish_ghoul 65. fiendish_ghoul Lv 1 1 pt. 9,439
  6. Avatar for Mohoernchen 66. Mohoernchen Lv 1 1 pt. 9,408
  7. Avatar for Dr.Sillem 67. Dr.Sillem Lv 1 1 pt. 9,407
  8. Avatar for Merf 68. Merf Lv 1 1 pt. 9,314
  9. Avatar for rinze 69. rinze Lv 1 1 pt. 9,301
  10. Avatar for pruneau_44 70. pruneau_44 Lv 1 1 pt. 9,300

Comments