Icon representing a puzzle

2290: Revisiting Puzzle 75: Antifreeze Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 17, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,153
  2. Avatar for Go Science 2. Go Science 68 pts. 10,137
  3. Avatar for Contenders 3. Contenders 44 pts. 10,112
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,040
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,024
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 10,007
  7. Avatar for SHELL 7. SHELL 5 pts. 9,933
  8. Avatar for Australia 8. Australia 3 pts. 9,929
  9. Avatar for WISE 380 Spring 21 A 9. WISE 380 Spring 21 A 1 pt. 9,773
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,700
  1. Avatar for guineapig 11. guineapig Lv 1 54 pts. 10,101
  2. Avatar for g_b 12. g_b Lv 1 51 pts. 10,098
  3. Avatar for drjr 13. drjr Lv 1 48 pts. 10,090
  4. Avatar for gmn 14. gmn Lv 1 45 pts. 10,082
  5. Avatar for silent gene 15. silent gene Lv 1 42 pts. 10,051
  6. Avatar for maithra 16. maithra Lv 1 39 pts. 10,042
  7. Avatar for Alistair69 17. Alistair69 Lv 1 36 pts. 10,040
  8. Avatar for roarshock 18. roarshock Lv 1 34 pts. 10,037
  9. Avatar for alcor29 19. alcor29 Lv 1 31 pts. 10,027
  10. Avatar for akaaka 20. akaaka Lv 1 29 pts. 10,024

Comments