Icon representing a puzzle

2290: Revisiting Puzzle 75: Antifreeze Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 17, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,153
  2. Avatar for Go Science 2. Go Science 68 pts. 10,137
  3. Avatar for Contenders 3. Contenders 44 pts. 10,112
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,040
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,024
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 10,007
  7. Avatar for SHELL 7. SHELL 5 pts. 9,933
  8. Avatar for Australia 8. Australia 3 pts. 9,929
  9. Avatar for WISE 380 Spring 21 A 9. WISE 380 Spring 21 A 1 pt. 9,773
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,700
  1. Avatar for ShadowTactics 51. ShadowTactics Lv 1 2 pts. 9,700
  2. Avatar for Hillbillie 52. Hillbillie Lv 1 2 pts. 9,689
  3. Avatar for Karlheinz 53. Karlheinz Lv 1 1 pt. 9,685
  4. Avatar for Oransche 54. Oransche Lv 1 1 pt. 9,670
  5. Avatar for matt61ger 55. matt61ger Lv 1 1 pt. 9,668
  6. Avatar for Trajan464 56. Trajan464 Lv 1 1 pt. 9,660
  7. Avatar for sciencewalker 57. sciencewalker Lv 1 1 pt. 9,653
  8. Avatar for Wiz kid 58. Wiz kid Lv 1 1 pt. 9,644
  9. Avatar for sitlux 59. sitlux Lv 1 1 pt. 9,638
  10. Avatar for Borets 60. Borets Lv 1 1 pt. 9,617

Comments