Icon representing a puzzle

2290: Revisiting Puzzle 75: Antifreeze Protein

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
April 17, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,153
  2. Avatar for Go Science 2. Go Science 68 pts. 10,137
  3. Avatar for Contenders 3. Contenders 44 pts. 10,112
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,040
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 16 pts. 10,024
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 10,007
  7. Avatar for SHELL 7. SHELL 5 pts. 9,933
  8. Avatar for Australia 8. Australia 3 pts. 9,929
  9. Avatar for WISE 380 Spring 21 A 9. WISE 380 Spring 21 A 1 pt. 9,773
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,700
  1. Avatar for lraguette 41. lraguette Lv 1 5 pts. 9,773
  2. Avatar for hansvandenhof 42. hansvandenhof Lv 1 4 pts. 9,762
  3. Avatar for Vinara 43. Vinara Lv 1 4 pts. 9,752
  4. Avatar for hada 44. hada Lv 1 4 pts. 9,749
  5. Avatar for ProfVince 45. ProfVince Lv 1 3 pts. 9,746
  6. Avatar for Idiotboy 46. Idiotboy Lv 1 3 pts. 9,741
  7. Avatar for Kiwegapa 47. Kiwegapa Lv 1 3 pts. 9,719
  8. Avatar for heather-1 48. heather-1 Lv 1 2 pts. 9,713
  9. Avatar for Arne Heessels 49. Arne Heessels Lv 1 2 pts. 9,712
  10. Avatar for pfirth 50. pfirth Lv 1 2 pts. 9,710

Comments