Placeholder image of a protein
Icon representing a puzzle

2300: Electron Density Reconstruction 39

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 15,063
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 14,862
  3. Avatar for SHELL 13. SHELL 1 pt. 14,811
  1. Avatar for abiogenesis 51. abiogenesis Lv 1 1 pt. 15,137
  2. Avatar for izzgood 52. izzgood Lv 1 1 pt. 15,118
  3. Avatar for Arne Heessels 53. Arne Heessels Lv 1 1 pt. 15,094
  4. Avatar for rosie4loop 54. rosie4loop Lv 1 1 pt. 15,088
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 15,074
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 15,073
  7. Avatar for Merf 57. Merf Lv 1 1 pt. 15,073
  8. Avatar for Dr.Sillem 58. Dr.Sillem Lv 1 1 pt. 15,064
  9. Avatar for alyssa_d_V2.0 59. alyssa_d_V2.0 Lv 1 1 pt. 15,063
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 15,004

Comments