Placeholder image of a protein
Icon representing a puzzle

2300: Electron Density Reconstruction 39

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary


Created
May 08, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMLPDSDVKQALQAIPEEFRIAVYLADVEGFAYKEIADIMGTPIGTVMSRLHRGRRQLRGMLEDYAR

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 15,063
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 14,862
  3. Avatar for SHELL 13. SHELL 1 pt. 14,811

  1. Avatar for ApolloniusSun 71. ApolloniusSun Lv 1 1 pt. 14,791
  2. Avatar for pruneau_44 72. pruneau_44 Lv 1 1 pt. 14,760
  3. Avatar for U202240095 73. U202240095 Lv 1 1 pt. 14,710
  4. Avatar for deathbat_87 74. deathbat_87 Lv 1 1 pt. 14,334
  5. Avatar for aripacon 75. aripacon Lv 1 1 pt. 14,302
  6. Avatar for U202242463 76. U202242463 Lv 1 1 pt. 11,533
  7. Avatar for lisabaltus 77. lisabaltus Lv 1 1 pt. 11,501
  8. Avatar for U202141954 78. U202141954 Lv 1 1 pt. 11,411
  9. Avatar for FwishCakes 79. FwishCakes Lv 1 1 pt. 11,411

Comments