Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since over 2 years ago

Beginner

Summary

Created
May 10, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 14,084
  2. Avatar for SHELL 2. SHELL 4 pts. 13,772
  3. Avatar for CH4110 Fold it! 3. CH4110 Fold it! 1 pt. 13,090
  1. Avatar for 9999MATT 11. 9999MATT Lv 1 8 pts. 14,084
  2. Avatar for Anne_sph 12. Anne_sph Lv 1 6 pts. 14,083
  3. Avatar for duncan_m 13. duncan_m Lv 1 4 pts. 13,999
  4. Avatar for ianbambooman6 14. ianbambooman6 Lv 1 3 pts. 13,918
  5. Avatar for sintel 15. sintel Lv 1 2 pts. 13,890
  6. Avatar for Just_A_Nerd 16. Just_A_Nerd Lv 1 2 pts. 13,870
  7. Avatar for brockmcneill 17. brockmcneill Lv 1 1 pt. 13,848
  8. Avatar for U202242494 18. U202242494 Lv 1 1 pt. 13,772
  9. Avatar for i tre foldettieri 19. i tre foldettieri Lv 1 1 pt. 13,688
  10. Avatar for royd 20. royd Lv 1 1 pt. 13,606

Comments