Icon representing a puzzle

Beginner Puzzle: Staphylococcus Aureus Electron Density

Closed since over 2 years ago

Beginner

Summary

Created
May 10, 2023
Expires
Max points
100
Description

In electron density puzzles, we give you some experimental data to help you find the correct fold. This data takes the form of an electron density, and appears in game as a guide. You can adjust the guide visualization from the Electron Density panel. This is a Beginner puzzle for new players that have joined Foldit in the last 6 months.

Sequence
MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 14,084
  2. Avatar for SHELL 2. SHELL 4 pts. 13,772
  3. Avatar for CH4110 Fold it! 3. CH4110 Fold it! 1 pt. 13,090
  1. Avatar for DiBSop2023 21. DiBSop2023 Lv 1 1 pt. 13,090
  2. Avatar for U202143311 22. U202143311 Lv 1 1 pt. 11,516
  3. Avatar for KryptonKing 23. KryptonKing Lv 1 1 pt. 11,405
  4. Avatar for marysha 24. marysha Lv 1 1 pt. 11,405
  5. Avatar for NickMihal 25. NickMihal Lv 1 1 pt. 11,405
  6. Avatar for TheFinn 26. TheFinn Lv 1 1 pt. 11,405

Comments