Placeholder image of a protein
Icon representing a puzzle

2303: Electron Density Reconstruction 40

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. The individual chains in this protein have the same sequence.

Sequence
RMKQLEDKVEELLSKAYHLENEVARLKKLVGER

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 23,066
  2. Avatar for SHELL 12. SHELL 1 pt. 22,985
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 22,984
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 22,929
  5. Avatar for JAWS PLAYERS 15. JAWS PLAYERS 1 pt. 22,601
  1. Avatar for roarshock 31. roarshock Lv 1 11 pts. 23,373
  2. Avatar for Idiotboy 32. Idiotboy Lv 1 10 pts. 23,335
  3. Avatar for SemperRabbit 33. SemperRabbit Lv 1 9 pts. 23,329
  4. Avatar for georg137 34. georg137 Lv 1 8 pts. 23,308
  5. Avatar for Trajan464 35. Trajan464 Lv 1 7 pts. 23,304
  6. Avatar for sciencewalker 36. sciencewalker Lv 1 7 pts. 23,303
  7. Avatar for ShadowTactics 37. ShadowTactics Lv 1 6 pts. 23,296
  8. Avatar for PhilipReichel 38. PhilipReichel Lv 1 5 pts. 23,290
  9. Avatar for hansvandenhof 39. hansvandenhof Lv 1 5 pts. 23,285
  10. Avatar for Wiz kid 40. Wiz kid Lv 1 4 pts. 23,279

Comments

LociOiling Lv 1

This one is a good match for PDB 1RB4 and several others, but the PDB entries seem to missing the last two residues ("ER") we see in this puzzle.

WBarme1234 Lv 1

2 equal helics Only +3rd helic missing 2residues at beginning of sequence
rmkqledkveellskayhlenevarlkklvg
rmkqledkveellskayhlenevarlkklvg
__kqledkveellskayhlenevarlkklvg
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
__LHHHHHHHHHHHHHHHHHHHHHHHHHHHL