Placeholder image of a protein
Icon representing a puzzle

2303: Electron Density Reconstruction 40

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
May 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. The individual chains in this protein have the same sequence.

Sequence
RMKQLEDKVEELLSKAYHLENEVARLKKLVGER

Top groups


  1. Avatar for Go Science 100 pts. 23,551
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 23,549
  3. Avatar for Contenders 3. Contenders 47 pts. 23,524
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 23,499
  5. Avatar for Australia 5. Australia 19 pts. 23,481
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 23,435
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 7 pts. 23,434
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 23,296
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 23,222
  10. Avatar for VeFold 10. VeFold 1 pt. 23,087

  1. Avatar for roarshock 31. roarshock Lv 1 11 pts. 23,373
  2. Avatar for Idiotboy 32. Idiotboy Lv 1 10 pts. 23,335
  3. Avatar for SemperRabbit 33. SemperRabbit Lv 1 9 pts. 23,329
  4. Avatar for georg137 34. georg137 Lv 1 8 pts. 23,308
  5. Avatar for Trajan464 35. Trajan464 Lv 1 7 pts. 23,304
  6. Avatar for sciencewalker 36. sciencewalker Lv 1 7 pts. 23,303
  7. Avatar for ShadowTactics 37. ShadowTactics Lv 1 6 pts. 23,296
  8. Avatar for PhilipReichel 38. PhilipReichel Lv 1 5 pts. 23,290
  9. Avatar for hansvandenhof 39. hansvandenhof Lv 1 5 pts. 23,285
  10. Avatar for Wiz kid 40. Wiz kid Lv 1 4 pts. 23,279

Comments


LociOiling Lv 1

This one is a good match for PDB 1RB4 and several others, but the PDB entries seem to missing the last two residues ("ER") we see in this puzzle.

WBarme1234 Lv 1

2 equal helics Only +3rd helic missing 2residues at beginning of sequence
rmkqledkveellskayhlenevarlkklvg
rmkqledkveellskayhlenevarlkklvg
__kqledkveellskayhlenevarlkklvg
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHL
__LHHHHHHHHHHHHHHHHHHHHHHHHHHHL