Icon representing a puzzle

2305: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
May 24, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 8,729
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 8,111
  3. Avatar for SHELL 13. SHELL 1 pt. 7,761
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 7,760
  1. Avatar for georg137 31. georg137 Lv 1 13 pts. 9,570
  2. Avatar for equilibria 32. equilibria Lv 1 12 pts. 9,566
  3. Avatar for ProfVince 33. ProfVince Lv 1 11 pts. 9,556
  4. Avatar for Oransche 34. Oransche Lv 1 10 pts. 9,550
  5. Avatar for heather-1 35. heather-1 Lv 1 10 pts. 9,454
  6. Avatar for Altercomp 36. Altercomp Lv 1 9 pts. 9,395
  7. Avatar for drjr 37. drjr Lv 1 8 pts. 9,349
  8. Avatar for Crossed Sticks 38. Crossed Sticks Lv 1 7 pts. 9,252
  9. Avatar for Wanderer09 39. Wanderer09 Lv 1 7 pts. 9,249
  10. Avatar for hada 40. hada Lv 1 6 pts. 9,143

Comments