Icon representing a puzzle

2305: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
May 24, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 8,729
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 8,111
  3. Avatar for SHELL 13. SHELL 1 pt. 7,761
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 7,760
  1. Avatar for Steven Pletsch 41. Steven Pletsch Lv 1 6 pts. 8,920
  2. Avatar for 9999MATT 42. 9999MATT Lv 1 5 pts. 8,918
  3. Avatar for pfirth 43. pfirth Lv 1 5 pts. 8,898
  4. Avatar for alyssa_d_V2.0 44. alyssa_d_V2.0 Lv 1 4 pts. 8,835
  5. Avatar for Dr.Sillem 45. Dr.Sillem Lv 1 4 pts. 8,824
  6. Avatar for BlueEqualsRed 46. BlueEqualsRed Lv 1 3 pts. 8,820
  7. Avatar for AlphaFold2 47. AlphaFold2 Lv 1 3 pts. 8,802
  8. Avatar for Larini 48. Larini Lv 1 3 pts. 8,777
  9. Avatar for machinelves 49. machinelves Lv 1 3 pts. 8,769
  10. Avatar for RichGuilmain 50. RichGuilmain Lv 1 2 pts. 8,742

Comments