Icon representing a puzzle

2305: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
May 24, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,368
  2. Avatar for Go Science 2. Go Science 68 pts. 10,160
  3. Avatar for FamilyBarmettler 3. FamilyBarmettler 44 pts. 10,082
  4. Avatar for Contenders 4. Contenders 27 pts. 10,014
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,926
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,846
  7. Avatar for Australia 7. Australia 5 pts. 9,792
  8. Avatar for Trinity Biology 8. Trinity Biology 3 pts. 8,835
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 8,802
  10. Avatar for :) 10. :) 1 pt. 8,769
  1. Avatar for Mohoernchen 71. Mohoernchen Lv 1 1 pt. 8,072
  2. Avatar for frostschutz 72. frostschutz Lv 1 1 pt. 8,006
  3. Avatar for ianbambooman6 73. ianbambooman6 Lv 1 1 pt. 7,985
  4. Avatar for mart0258 74. mart0258 Lv 1 1 pt. 7,832
  5. Avatar for PhilipReichel 75. PhilipReichel Lv 1 1 pt. 7,830
  6. Avatar for illex 76. illex Lv 1 1 pt. 7,783
  7. Avatar for Swapper242 77. Swapper242 Lv 1 1 pt. 7,768
  8. Avatar for U202240756 78. U202240756 Lv 1 1 pt. 7,761
  9. Avatar for andrewgood 79. andrewgood Lv 1 1 pt. 7,760
  10. Avatar for U202240009 80. U202240009 Lv 1 1 pt. 7,676

Comments