2305: Revisiting Puzzle 80: Calcium Channel Blocker
Closed since almost 3 years ago
Novice Overall PredictionSummary
- Created
- May 24, 2023
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
- Sequence
- WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK
Top groups
-
100 pts. 10,368
-
-
-
-
-
-
-
-
-
Comments