Placeholder image of a protein
Icon representing a puzzle

2309: Electron Density Reconstruction 42

Closed since almost 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
May 30, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This case has several of the same sequence in it (although visible segments might be different for different copies), and is pretty large, so trim tool may be necessary

Sequence
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAISDPMALAKAKEIVASAPVVVFSKSYCPFCVQVKKLFTQLGASFKAIELDTESDGTEIQSALAEWTGQRTVPNVFINGKHIGGCDDTIALNKGGKLVALLTEAGAISGSSSKTTVTPLEHHHHHH

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 63,457
  2. Avatar for :) 12. :) 1 pt. 58,280
  3. Avatar for Team China 13. Team China 1 pt. 54,777
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 53,852
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 53,048
  6. Avatar for Ogre's lab 16. Ogre's lab 1 pt. 10,845
  7. Avatar for Street Smarts 17. Street Smarts 1 pt. 8,357
  1. Avatar for ShadowTactics 31. ShadowTactics Lv 1 8 pts. 63,457
  2. Avatar for manu8170 32. manu8170 Lv 1 7 pts. 63,175
  3. Avatar for hada 33. hada Lv 1 6 pts. 63,064
  4. Avatar for BootsMcGraw 34. BootsMcGraw Lv 1 6 pts. 62,716
  5. Avatar for RichGuilmain 35. RichGuilmain Lv 1 5 pts. 62,463
  6. Avatar for Flagg65a 36. Flagg65a Lv 1 5 pts. 62,253
  7. Avatar for Altercomp 37. Altercomp Lv 1 4 pts. 62,065
  8. Avatar for Oransche 38. Oransche Lv 1 4 pts. 62,019
  9. Avatar for zbp 39. zbp Lv 1 3 pts. 61,782
  10. Avatar for HavocOrder0999 40. HavocOrder0999 Lv 1 3 pts. 61,135

Comments

LociOiling Lv 1

Also, as spotted by the eagle-eyed gmn, this is the second puzzle 2308. Maybe we can call this one 2309?