Icon representing a puzzle

2311: Revisiting Puzzle 82: Cytotoxin

Closed since almost 3 years ago

Novice Overall Prediction

Summary

Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for VeFold 11. VeFold 1 pt. 8,681
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,295
  3. Avatar for Russian team 13. Russian team 1 pt. 8,121
  1. Avatar for Fabio 71. Fabio Lv 1 1 pt. 7,956
  2. Avatar for chaperone 72. chaperone Lv 1 1 pt. 7,952
  3. Avatar for FilGC 73. FilGC Lv 1 1 pt. 7,938
  4. Avatar for giuliacrisci 74. giuliacrisci Lv 1 1 pt. 7,937
  5. Avatar for rinze 75. rinze Lv 1 1 pt. 7,925
  6. Avatar for BlueEqualsRed 76. BlueEqualsRed Lv 1 1 pt. 7,921
  7. Avatar for GAF 77. GAF Lv 1 1 pt. 7,909
  8. Avatar for Shiran 78. Shiran Lv 1 1 pt. 7,852
  9. Avatar for i tre foldettieri 2 79. i tre foldettieri 2 Lv 1 1 pt. 7,833
  10. Avatar for davitzeiro42 80. davitzeiro42 Lv 1 1 pt. 7,826

Comments