Icon representing a puzzle

2311: Revisiting Puzzle 82: Cytotoxin

Closed since almost 3 years ago

Novice Overall Prediction

Summary


Created
June 09, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups


  1. Avatar for VeFold 11. VeFold 1 pt. 8,681
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,295
  3. Avatar for Russian team 13. Russian team 1 pt. 8,121

  1. Avatar for EQUIPE 81. EQUIPE Lv 1 1 pt. 7,808
  2. Avatar for Tonzi 82. Tonzi Lv 1 1 pt. 7,775
  3. Avatar for Jaydon 83. Jaydon Lv 1 1 pt. 7,769
  4. Avatar for Tetrominous 84. Tetrominous Lv 1 1 pt. 7,715
  5. Avatar for Swapper242 85. Swapper242 Lv 1 1 pt. 7,687
  6. Avatar for furi0us 86. furi0us Lv 1 1 pt. 7,647
  7. Avatar for apetrides 87. apetrides Lv 1 1 pt. 7,619
  8. Avatar for agautieri 88. agautieri Lv 1 1 pt. 7,534
  9. Avatar for AtomicPuttyRien 89. AtomicPuttyRien Lv 1 1 pt. 7,443
  10. Avatar for hansvandenhof 90. hansvandenhof Lv 1 1 pt. 7,367

Comments