Placeholder image of a protein
Icon representing a puzzle

2321: Electron Density Reconstruction 46

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
June 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it.

Sequence
MDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGILEHHHHHH

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 23,938
  2. Avatar for VeFold 12. VeFold 1 pt. 23,938
  3. Avatar for :) 13. :) 1 pt. 23,628
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 22,767
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 22,745
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 4,514

  1. Avatar for Idiotboy 31. Idiotboy Lv 1 10 pts. 24,475
  2. Avatar for georg137 32. georg137 Lv 1 9 pts. 24,406
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 9 pts. 24,401
  4. Avatar for Flagg65a 34. Flagg65a Lv 1 8 pts. 24,338
  5. Avatar for rezaefar 35. rezaefar Lv 1 7 pts. 24,296
  6. Avatar for roarshock 36. roarshock Lv 1 6 pts. 24,147
  7. Avatar for rosie4loop 37. rosie4loop Lv 1 6 pts. 24,137
  8. Avatar for equilibria 38. equilibria Lv 1 5 pts. 24,116
  9. Avatar for Joanna_H 39. Joanna_H Lv 1 5 pts. 24,037
  10. Avatar for hansvandenhof 40. hansvandenhof Lv 1 4 pts. 24,028

Comments