Placeholder image of a protein
Icon representing a puzzle

2321: Electron Density Reconstruction 46

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
June 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it.

Sequence
MDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGILEHHHHHH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 25,229
  2. Avatar for Go Science 2. Go Science 71 pts. 25,178
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 25,073
  4. Avatar for Contenders 4. Contenders 33 pts. 25,022
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 24,902
  6. Avatar for Australia 6. Australia 14 pts. 24,664
  7. Avatar for BOINC@Poland 7. BOINC@Poland 8 pts. 24,574
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 24,516
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 24,037
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 23,961
  1. Avatar for Idiotboy 31. Idiotboy Lv 1 10 pts. 24,475
  2. Avatar for georg137 32. georg137 Lv 1 9 pts. 24,406
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 9 pts. 24,401
  4. Avatar for Flagg65a 34. Flagg65a Lv 1 8 pts. 24,338
  5. Avatar for rezaefar 35. rezaefar Lv 1 7 pts. 24,296
  6. Avatar for roarshock 36. roarshock Lv 1 6 pts. 24,147
  7. Avatar for rosie4loop 37. rosie4loop Lv 1 6 pts. 24,137
  8. Avatar for equilibria 38. equilibria Lv 1 5 pts. 24,116
  9. Avatar for Joanna_H 39. Joanna_H Lv 1 5 pts. 24,037
  10. Avatar for hansvandenhof 40. hansvandenhof Lv 1 4 pts. 24,028

Comments