Placeholder image of a protein
Icon representing a puzzle

2321: Electron Density Reconstruction 46

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
June 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it.

Sequence
MDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGILEHHHHHH

Top groups

  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 23,938
  2. Avatar for VeFold 12. VeFold 1 pt. 23,938
  3. Avatar for :) 13. :) 1 pt. 23,628
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 22,767
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 22,745
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 4,514
  1. Avatar for hada 41. hada Lv 1 4 pts. 23,996
  2. Avatar for Trajan464 42. Trajan464 Lv 1 3 pts. 23,994
  3. Avatar for firejuggler 43. firejuggler Lv 1 3 pts. 23,961
  4. Avatar for AlphaFold2 44. AlphaFold2 Lv 1 3 pts. 23,938
  5. Avatar for zbp 45. zbp Lv 1 2 pts. 23,874
  6. Avatar for Oransche 46. Oransche Lv 1 2 pts. 23,841
  7. Avatar for mengzach 47. mengzach Lv 1 2 pts. 23,806
  8. Avatar for jamiexq 48. jamiexq Lv 1 2 pts. 23,763
  9. Avatar for G Man 49. G Man Lv 1 2 pts. 23,683
  10. Avatar for ProfVince 50. ProfVince Lv 1 1 pt. 23,670

Comments