Placeholder image of a protein
Icon representing a puzzle

2321: Electron Density Reconstruction 46

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
June 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it.

Sequence
MDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGILEHHHHHH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 25,229
  2. Avatar for Go Science 2. Go Science 71 pts. 25,178
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 25,073
  4. Avatar for Contenders 4. Contenders 33 pts. 25,022
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 24,902
  6. Avatar for Australia 6. Australia 14 pts. 24,664
  7. Avatar for BOINC@Poland 7. BOINC@Poland 8 pts. 24,574
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 24,516
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 24,037
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 23,961

  1. Avatar for hada 41. hada Lv 1 4 pts. 23,996
  2. Avatar for Trajan464 42. Trajan464 Lv 1 3 pts. 23,994
  3. Avatar for firejuggler 43. firejuggler Lv 1 3 pts. 23,961
  4. Avatar for AlphaFold2 44. AlphaFold2 Lv 1 3 pts. 23,938
  5. Avatar for zbp 45. zbp Lv 1 2 pts. 23,874
  6. Avatar for Oransche 46. Oransche Lv 1 2 pts. 23,841
  7. Avatar for mengzach 47. mengzach Lv 1 2 pts. 23,806
  8. Avatar for jamiexq 48. jamiexq Lv 1 2 pts. 23,763
  9. Avatar for G Man 49. G Man Lv 1 2 pts. 23,683
  10. Avatar for ProfVince 50. ProfVince Lv 1 1 pt. 23,670

Comments