Placeholder image of a protein
Icon representing a puzzle

2321: Electron Density Reconstruction 46

Closed since almost 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
June 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it.

Sequence
MDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGILEHHHHHH

Top groups


  1. Avatar for AlphaFold 11. AlphaFold 1 pt. 23,938
  2. Avatar for VeFold 12. VeFold 1 pt. 23,938
  3. Avatar for :) 13. :) 1 pt. 23,628
  4. Avatar for Andrew's Foldit group 14. Andrew's Foldit group 1 pt. 22,767
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 22,745
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 4,514

  1. Avatar for rinze 61. rinze Lv 1 1 pt. 23,078
  2. Avatar for Larini 62. Larini Lv 1 1 pt. 23,076
  3. Avatar for CDSoffice 63. CDSoffice Lv 1 1 pt. 23,071
  4. Avatar for NickMihal 64. NickMihal Lv 1 1 pt. 23,008
  5. Avatar for argyrw 65. argyrw Lv 1 1 pt. 22,916
  6. Avatar for pruneau_44 66. pruneau_44 Lv 1 1 pt. 22,839
  7. Avatar for DScott 67. DScott Lv 1 1 pt. 22,831
  8. Avatar for B. A. Beder 68. B. A. Beder Lv 1 1 pt. 22,777
  9. Avatar for andrewgood 69. andrewgood Lv 1 1 pt. 22,767
  10. Avatar for apetrides 70. apetrides Lv 1 1 pt. 22,763

Comments