Placeholder image of a protein
Icon representing a puzzle

2321: Electron Density Reconstruction 46

Closed since over 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
June 15, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This structure has two copies in it.

Sequence
MDGVYVLSVKEDVPAAGILHAGDLITEIDGQSFKSSQEFIDYIHSKKVGDTVKIKYKHGNKNEEASIKLTAIDKKGTPGIGILEHHHHHH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 25,229
  2. Avatar for Go Science 2. Go Science 71 pts. 25,178
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 25,073
  4. Avatar for Contenders 4. Contenders 33 pts. 25,022
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 24,902
  6. Avatar for Australia 6. Australia 14 pts. 24,664
  7. Avatar for BOINC@Poland 7. BOINC@Poland 8 pts. 24,574
  8. Avatar for Marvin's bunch 8. Marvin's bunch 5 pts. 24,516
  9. Avatar for Gargleblasters 9. Gargleblasters 3 pts. 24,037
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 23,961
  1. Avatar for rinze 61. rinze Lv 1 1 pt. 23,078
  2. Avatar for Larini 62. Larini Lv 1 1 pt. 23,076
  3. Avatar for CDSoffice 63. CDSoffice Lv 1 1 pt. 23,071
  4. Avatar for NickMihal 64. NickMihal Lv 1 1 pt. 23,008
  5. Avatar for argyrw 65. argyrw Lv 1 1 pt. 22,916
  6. Avatar for pruneau_44 66. pruneau_44 Lv 1 1 pt. 22,839
  7. Avatar for DScott 67. DScott Lv 1 1 pt. 22,831
  8. Avatar for B. A. Beder 68. B. A. Beder Lv 1 1 pt. 22,777
  9. Avatar for andrewgood 69. andrewgood Lv 1 1 pt. 22,767
  10. Avatar for apetrides 70. apetrides Lv 1 1 pt. 22,763

Comments