Icon representing a puzzle

2320: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,020
  2. Avatar for Contenders 2. Contenders 68 pts. 9,891
  3. Avatar for Go Science 3. Go Science 44 pts. 9,878
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 9,645
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 9,536
  6. Avatar for Australia 6. Australia 9 pts. 9,487
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 9,460
  8. Avatar for BOINC@Poland 8. BOINC@Poland 3 pts. 9,153
  9. Avatar for VeFold 9. VeFold 1 pt. 9,123
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 9,121
  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 47 pts. 9,734
  2. Avatar for akaaka 12. akaaka Lv 1 44 pts. 9,713
  3. Avatar for alcor29 13. alcor29 Lv 1 40 pts. 9,675
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 37 pts. 9,645
  5. Avatar for BackBuffer 15. BackBuffer Lv 1 34 pts. 9,640
  6. Avatar for phi16 16. phi16 Lv 1 31 pts. 9,634
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 28 pts. 9,624
  8. Avatar for Punzi Baker 3 18. Punzi Baker 3 Lv 1 26 pts. 9,621
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 24 pts. 9,607
  10. Avatar for guineapig 20. guineapig Lv 1 22 pts. 9,604

Comments