Icon representing a puzzle

2320: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 05, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we are modeling them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,020
  2. Avatar for Contenders 2. Contenders 68 pts. 9,891
  3. Avatar for Go Science 3. Go Science 44 pts. 9,878
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 9,645
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 9,536
  6. Avatar for Australia 6. Australia 9 pts. 9,487
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 9,460
  8. Avatar for BOINC@Poland 8. BOINC@Poland 3 pts. 9,153
  9. Avatar for VeFold 9. VeFold 1 pt. 9,123
  10. Avatar for AlphaFold 10. AlphaFold 1 pt. 9,121
  1. Avatar for silent gene 21. silent gene Lv 1 20 pts. 9,604
  2. Avatar for g_b 22. g_b Lv 1 18 pts. 9,572
  3. Avatar for fpc 23. fpc Lv 1 16 pts. 9,536
  4. Avatar for Hillbillie 24. Hillbillie Lv 1 15 pts. 9,526
  5. Avatar for roarshock 25. roarshock Lv 1 13 pts. 9,522
  6. Avatar for maithra 26. maithra Lv 1 12 pts. 9,511
  7. Avatar for heather-1 27. heather-1 Lv 1 11 pts. 9,494
  8. Avatar for AlkiP0Ps 28. AlkiP0Ps Lv 1 10 pts. 9,487
  9. Avatar for WBarme1234 29. WBarme1234 Lv 1 9 pts. 9,460
  10. Avatar for Idiotboy 30. Idiotboy Lv 1 8 pts. 9,444

Comments