Icon representing a puzzle

2334: Revisiting Puzzle 89: Cow Eye

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 20, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,355
  2. Avatar for Go Science 2. Go Science 63 pts. 11,291
  3. Avatar for Marvin's bunch 3. Marvin's bunch 37 pts. 11,251
  4. Avatar for Contenders 4. Contenders 21 pts. 11,230
  5. Avatar for Gargleblasters 5. Gargleblasters 11 pts. 11,194
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 11,162
  7. Avatar for Australia 7. Australia 2 pts. 11,087
  8. Avatar for AlphaFold 8. AlphaFold 1 pt. 10,937
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 10,914
  10. Avatar for Tableau ACE 10. Tableau ACE 1 pt. 10,461
  1. Avatar for MicElephant 11. MicElephant Lv 1 48 pts. 11,230
  2. Avatar for blazegeek 12. blazegeek Lv 1 45 pts. 11,204
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 41 pts. 11,203
  4. Avatar for Joanna_H 14. Joanna_H Lv 1 38 pts. 11,194
  5. Avatar for guineapig 15. guineapig Lv 1 35 pts. 11,187
  6. Avatar for ichwilldiesennamen 16. ichwilldiesennamen Lv 1 32 pts. 11,183
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 30 pts. 11,181
  8. Avatar for christioanchauvin 18. christioanchauvin Lv 1 27 pts. 11,162
  9. Avatar for g_b 19. g_b Lv 1 25 pts. 11,124
  10. Avatar for dcrwheeler 20. dcrwheeler Lv 1 23 pts. 11,102

Comments