Icon representing a puzzle

2334: Revisiting Puzzle 89: Cow Eye

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
July 20, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,355
  2. Avatar for Go Science 2. Go Science 63 pts. 11,291
  3. Avatar for Marvin's bunch 3. Marvin's bunch 37 pts. 11,251
  4. Avatar for Contenders 4. Contenders 21 pts. 11,230
  5. Avatar for Gargleblasters 5. Gargleblasters 11 pts. 11,194
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 11,162
  7. Avatar for Australia 7. Australia 2 pts. 11,087
  8. Avatar for AlphaFold 8. AlphaFold 1 pt. 10,937
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 10,914
  10. Avatar for Tableau ACE 10. Tableau ACE 1 pt. 10,461

  1. Avatar for Gonegirl 31. Gonegirl Lv 1 8 pts. 10,954
  2. Avatar for AlphaFold2 32. AlphaFold2 Lv 1 7 pts. 10,937
  3. Avatar for SemperRabbit 33. SemperRabbit Lv 1 6 pts. 10,929
  4. Avatar for hada 34. hada Lv 1 5 pts. 10,926
  5. Avatar for WBarme1234 35. WBarme1234 Lv 1 5 pts. 10,914
  6. Avatar for jausmh 36. jausmh Lv 1 4 pts. 10,895
  7. Avatar for heather-1 37. heather-1 Lv 1 4 pts. 10,849
  8. Avatar for argyrw 38. argyrw Lv 1 3 pts. 10,826
  9. Avatar for maithra 39. maithra Lv 1 3 pts. 10,803
  10. Avatar for zbp 40. zbp Lv 1 3 pts. 10,786

Comments