Icon representing a puzzle

2334: Revisiting Puzzle 89: Cow Eye

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
July 20, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,355
  2. Avatar for Go Science 2. Go Science 63 pts. 11,291
  3. Avatar for Marvin's bunch 3. Marvin's bunch 37 pts. 11,251
  4. Avatar for Contenders 4. Contenders 21 pts. 11,230
  5. Avatar for Gargleblasters 5. Gargleblasters 11 pts. 11,194
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 11,162
  7. Avatar for Australia 7. Australia 2 pts. 11,087
  8. Avatar for AlphaFold 8. AlphaFold 1 pt. 10,937
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 10,914
  10. Avatar for Tableau ACE 10. Tableau ACE 1 pt. 10,461
  1. Avatar for mnucer 51. mnucer Lv 1 1 pt. 10,459
  2. Avatar for Simek 52. Simek Lv 1 1 pt. 10,447
  3. Avatar for pfirth 53. pfirth Lv 1 1 pt. 10,398
  4. Avatar for Larini 54. Larini Lv 1 1 pt. 10,285
  5. Avatar for DScott 55. DScott Lv 1 1 pt. 10,280
  6. Avatar for abiogenesis 56. abiogenesis Lv 1 1 pt. 10,244
  7. Avatar for Merf 57. Merf Lv 1 1 pt. 10,239
  8. Avatar for Altercomp 58. Altercomp Lv 1 1 pt. 10,221
  9. Avatar for carxo 59. carxo Lv 1 1 pt. 10,215
  10. Avatar for heyubob 60. heyubob Lv 1 1 pt. 10,210

Comments