Icon representing a puzzle

2337: Revisiting Puzzle 90: Heliomicin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,834
  2. Avatar for Go Science 2. Go Science 63 pts. 9,760
  3. Avatar for Contenders 3. Contenders 37 pts. 9,720
  4. Avatar for VeFold 4. VeFold 21 pts. 9,659
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 11 pts. 9,591
  6. Avatar for Australia 6. Australia 5 pts. 9,516
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 2 pts. 9,509
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 9,451
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 9,252
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 9,049
  1. Avatar for equilibria 21. equilibria Lv 1 21 pts. 9,513
  2. Avatar for nicobul 22. nicobul Lv 1 19 pts. 9,509
  3. Avatar for fiendish_ghoul 23. fiendish_ghoul Lv 1 17 pts. 9,508
  4. Avatar for Aubade01 24. Aubade01 Lv 1 16 pts. 9,501
  5. Avatar for heather-1 25. heather-1 Lv 1 14 pts. 9,500
  6. Avatar for Bruno Kestemont 26. Bruno Kestemont Lv 1 13 pts. 9,463
  7. Avatar for ucad 27. ucad Lv 1 12 pts. 9,457
  8. Avatar for fpc 28. fpc Lv 1 10 pts. 9,451
  9. Avatar for hansvandenhof 29. hansvandenhof Lv 1 9 pts. 9,440
  10. Avatar for alcor29 30. alcor29 Lv 1 8 pts. 9,424

Comments