Icon representing a puzzle

2337: Revisiting Puzzle 90: Heliomicin

Closed since over 2 years ago

Novice Overall Prediction

Summary

Created
August 11, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,834
  2. Avatar for Go Science 2. Go Science 63 pts. 9,760
  3. Avatar for Contenders 3. Contenders 37 pts. 9,720
  4. Avatar for VeFold 4. VeFold 21 pts. 9,659
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 11 pts. 9,591
  6. Avatar for Australia 6. Australia 5 pts. 9,516
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 2 pts. 9,509
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 9,451
  9. Avatar for AlphaFold 9. AlphaFold 1 pt. 9,252
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 9,049
  1. Avatar for Flagg65a 31. Flagg65a Lv 1 8 pts. 9,318
  2. Avatar for ProfVince 32. ProfVince Lv 1 7 pts. 9,293
  3. Avatar for christioanchauvin 33. christioanchauvin Lv 1 6 pts. 9,283
  4. Avatar for Anfinsen_slept_here 34. Anfinsen_slept_here Lv 1 5 pts. 9,260
  5. Avatar for maithra 35. maithra Lv 1 5 pts. 9,259
  6. Avatar for AlphaFold2 36. AlphaFold2 Lv 1 4 pts. 9,252
  7. Avatar for georg137 37. georg137 Lv 1 4 pts. 9,223
  8. Avatar for rosie4loop 38. rosie4loop Lv 1 3 pts. 9,211
  9. Avatar for phi16 39. phi16 Lv 1 3 pts. 9,125
  10. Avatar for DScott 40. DScott Lv 1 3 pts. 9,114

Comments