Icon representing a puzzle

2349: Revisiting Puzzle 94: Mouse

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
August 16, 2023
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 8,804
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 8,761
  3. Avatar for Belgium 13. Belgium 1 pt. 8,456
  4. Avatar for Weber CHM3010 F2020 14. Weber CHM3010 F2020 1 pt. 8,203

  1. Avatar for TheFandomNerd 81. TheFandomNerd Lv 1 1 pt. 6,787
  2. Avatar for koolcoder101 82. koolcoder101 Lv 1 1 pt. 6,721
  3. Avatar for Andrey_ace 83. Andrey_ace Lv 1 1 pt. 6,613
  4. Avatar for manzet 84. manzet Lv 1 1 pt. 6,607
  5. Avatar for rhastings 85. rhastings Lv 1 1 pt. 6,428
  6. Avatar for cravens_riley 86. cravens_riley Lv 1 1 pt. 5,936
  7. Avatar for Ruslan 87. Ruslan Lv 1 1 pt. 4,489
  8. Avatar for amandaposkitt 88. amandaposkitt Lv 1 1 pt. 4,313
  9. Avatar for phi16 89. phi16 Lv 1 1 pt. 668
  10. Avatar for hilaolu 90. hilaolu Lv 1 1 pt. 668

Comments


Will the pill Lv 1

There seems to be some mismatch between the description and the puzzle. The description has 70 segments and two disulfide bonds; the puzzle has 48 segments and five disulfide bonds. FYI.

LociOiling Lv 1

Here I was going to joke that there's always more than one mouse. There are two "mouse" revisiting puzzles, but this is not one of them. Instead, it appears to be a repost of revisiting puzzle 93. We just wrapped another revisit to that puzzle today (2346), so it's a little soon. Not sure if the Foldit team will post the correct puzzle or let it roll.