Placeholder image of a protein
Icon representing a puzzle

2347: Electron Density Reconstruction 55

Closed since over 2 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
August 25, 2023
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
MARIRHEKEKLLADLDWEIGEIAQYTPLIVDFLVPDDILAMAADGLTPELKEKIQNEIIENHIALMALEEYSSLEHHHHHH

Top groups


  1. Avatar for Andrew's Foldit group 11. Andrew's Foldit group 1 pt. 16,259
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 16,257

  1. Avatar for equilibria 41. equilibria Lv 1 1 pt. 17,485
  2. Avatar for Trajan464 42. Trajan464 Lv 1 1 pt. 17,454
  3. Avatar for Merf 43. Merf Lv 1 1 pt. 17,406
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 1 pt. 17,392
  5. Avatar for Gonegirl 45. Gonegirl Lv 1 1 pt. 17,368
  6. Avatar for carxo 46. carxo Lv 1 1 pt. 17,307
  7. Avatar for DScott 47. DScott Lv 1 1 pt. 17,247
  8. Avatar for Docilya 48. Docilya Lv 1 1 pt. 17,046
  9. Avatar for RichGuilmain 49. RichGuilmain Lv 1 1 pt. 16,932
  10. Avatar for svman 50. svman Lv 1 1 pt. 16,825

Comments


Artoria2e5 Lv 1

This looks like PDB 3T4R. You may find some unexpectedly chunky density around M39 (PDB# A 41) and M64 (PDB# A 66); that's because the original crystal uses selenomethionine, which replaces the S with Se. The bunch of H at the end is not part of the native sequence, but a His-tag.